PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA014813-PA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 203aa    MW: 22444.2 Da    PI: 7.5817
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA014813-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.3e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  BGIOSGA014813-PA  4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                      6******99*********************6678888898877 PP

2zf-B_box27.28.2e-095586334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  BGIOSGA014813-PA 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86
                      589**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.096147IPR000315B-box-type zinc finger
PfamPF006432.0E-5447IPR000315B-box-type zinc finger
SMARTSM003364.6E-9447IPR000315B-box-type zinc finger
SMARTSM003366.2E-1453100IPR000315B-box-type zinc finger
PROSITE profilePS501198.54653100IPR000315B-box-type zinc finger
PfamPF006431.9E-65696IPR000315B-box-type zinc finger
CDDcd000213.03E-65686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LPAALPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGKHQRYLT TGIRVGFSSV CSAKADHLPP  120
PAPKXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXLS SSPRRSQRAT WGSTRRAGQR  180
QSKKPRVEIP DDDEDFFIVP DLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1000630.0callus| flower| leaf| panicle| root| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018830.0AB001883.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:E10707.
GenBankHQ3248050.0HQ324805.1 Oryza sativa Japonica Group clone KCB761B05 zinc finger protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636444.18e-83PREDICTED: B-box zinc finger protein 24
SwissprotQ962884e-52BBX24_ARATH; B-box zinc finger protein 24
TrEMBLO821139e-83O82113_ORYSJ; OJ990528_30.8 protein
STRINGBGIOSGA014813-PA1e-113(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.23e-35DBB family protein